Lineage for d4kxze_ (4kxz E:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638499Protein TGF-beta2 [57510] (2 species)
  7. 2638500Species Human (Homo sapiens) [TaxId:9606] [57511] (5 PDB entries)
  8. 2638508Domain d4kxze_: 4kxz E: [259783]
    Other proteins in same PDB: d4kxzi1, d4kxzi2, d4kxzl1, d4kxzl2, d4kxzm1, d4kxzm2, d4kxzp1, d4kxzp2
    automated match to d2tgia_
    complexed with mes, pe5

Details for d4kxze_

PDB Entry: 4kxz (more details), 2.83 Å

PDB Description: crystal structure of tgfb2 in complex with GC2008.
PDB Compounds: (E:) Transforming growth factor beta-2

SCOPe Domain Sequences for d4kxze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxze_ g.17.1.2 (E:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs

SCOPe Domain Coordinates for d4kxze_:

Click to download the PDB-style file with coordinates for d4kxze_.
(The format of our PDB-style files is described here.)

Timeline for d4kxze_: