Class g: Small proteins [56992] (98 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein TGF-beta2 [57510] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [57511] (5 PDB entries) |
Domain d4kxze_: 4kxz E: [259783] Other proteins in same PDB: d4kxzi1, d4kxzi2, d4kxzl1, d4kxzl2, d4kxzm1, d4kxzm2, d4kxzp1, d4kxzp2 automated match to d2tgia_ complexed with mes, pe5 |
PDB Entry: 4kxz (more details), 2.83 Å
SCOPe Domain Sequences for d4kxze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kxze_ g.17.1.2 (E:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]} aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
Timeline for d4kxze_: