Lineage for d4ktte_ (4ktt E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095073Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2095197Domain d4ktte_: 4ktt E: [259781]
    Other proteins in same PDB: d4ktta1, d4ktta2, d4ktta3, d4kttb1, d4kttb2, d4kttb3, d4kttc1, d4kttc2, d4kttc3, d4kttd1, d4kttd2, d4kttd3
    automated match to d3sc6a_
    complexed with edo, mg, po4, sam

Details for d4ktte_

PDB Entry: 4ktt (more details), 2.59 Å

PDB Description: Structural insights of MAT enzymes: MATa2b complexed with SAM
PDB Compounds: (E:) methionine adenosyltransferase 2 subunit beta

SCOPe Domain Sequences for d4ktte_:

Sequence, based on SEQRES records: (download)

>d4ktte_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
rwrqtvfh

Sequence, based on observed residues (ATOM records): (download)

>d4ktte_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
dafnlpsshlrpitdspvlqrprnaqldcskletlgigqrtpfrigikeslwpflidkrw
rqtvfh

SCOPe Domain Coordinates for d4ktte_:

Click to download the PDB-style file with coordinates for d4ktte_.
(The format of our PDB-style files is described here.)

Timeline for d4ktte_: