SCOP 1.73: Domain d1slub_: 1slu B:

Lineage for d1slub_ (1slu B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (33 PDB entries)

8. Domain d1slub_: 1slu B: [25977]
   Other proteins in same PDB: d1slua_
   complexed with act, ca; mutant

Details for d1slub_

PDB Entry: 1slu, 1.8 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin

PDB Compounds: (B:) anionic trypsin

SCOP Domain Sequences for d1slub_:

Sequence, based on SEQRES records:

>d1slub_ b.47.1.2 (B:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wghtlssgvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records):

>d1slub_ b.47.1.2 (B:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvkvatvalpsscapagtqclisgwght
lvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngel
qgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1slub_:

• d1slub_ first appeared (with stable ids) in SCOP 1.55
  
• d1slub_ appears in SCOP 1.71
  
• d1slub_ appears in SCOP 1.75
  
• d1slub_ appears in the current release, SCOPe 2.08