Lineage for d1slub_ (1slu B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2057319Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2057333Domain d1slub_: 1slu B: [25977]
    Other proteins in same PDB: d1slua_
    complexed with act, ca

Details for d1slub_

PDB Entry: 1slu (more details), 1.8 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin
PDB Compounds: (B:) anionic trypsin

SCOPe Domain Sequences for d1slub_:

Sequence, based on SEQRES records: (download)

>d1slub_ b.47.1.2 (B:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wghtlssgvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records): (download)

>d1slub_ b.47.1.2 (B:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvkvatvalpsscapagtqclisgwght
lvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngel
qgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1slub_:

Click to download the PDB-style file with coordinates for d1slub_.
(The format of our PDB-style files is described here.)

Timeline for d1slub_: