Lineage for d4d01a1 (4d01 A:2-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2074530Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)
  8. 2074533Domain d4d01a1: 4d01 A:2-212 [259758]
    Other proteins in same PDB: d4d01a2
    automated match to d3sq6a_
    complexed with edo, nag

Details for d4d01a1

PDB Entry: 4d01 (more details), 1.8 Å

PDB Description: Crystal Structure of the Extracellular Domain of the Human Alpha9 Nicotinic Acetylcholine Receptor
PDB Compounds: (A:) neuronal acetylcholine receptor subunit alpha-9

SCOPe Domain Sequences for d4d01a1:

Sequence, based on SEQRES records: (download)

>d4d01a1 b.96.1.0 (A:2-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqi
whdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitwd
apaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevh
gmpavknvisygccsepypdvtftlllkrrs

Sequence, based on observed residues (ATOM records): (download)

>d4d01a1 b.96.1.0 (A:2-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqi
whdayltwdrdqydgldsiripsdlvwrpdivlynkaddeepvntnvvlrydglitwdap
aitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgm
pavknvisygccsepypdvtftlllkrrs

SCOPe Domain Coordinates for d4d01a1:

Click to download the PDB-style file with coordinates for d4d01a1.
(The format of our PDB-style files is described here.)

Timeline for d4d01a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d01a2