![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
![]() | Domain d4d09c_: 4d09 C: [259756] automated match to d3b2ra_ complexed with 788, mg, zn |
PDB Entry: 4d09 (more details), 2.5 Å
SCOPe Domain Sequences for d4d09c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d09c_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvk kgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsf qvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiila tdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliy keffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelyer vasnrehwtkvshkftirglpsnnsldfl
Timeline for d4d09c_: