SCOPe 2.08: Domain d4c4ko1: 4c4k O:9-100

Lineage for d4c4ko1 (4c4k O:9-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4c4ko1: 4c4k O:9-100 [259754]
   Other proteins in same PDB: d4c4ko2
   automated match to d3puca_
   complexed with edo

Details for d4c4ko1

PDB Entry: 4c4k, 1.95 Å

PDB Description: crystal structure of the titin m10-obscurin ig domain 1 complex

PDB Compounds: (O:) Obscurin

SCOPe Domain Sequences for d4c4ko1:

Sequence; same for both SEQRES and ATOM records:

>d4c4ko1 b.1.1.0 (O:9-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprfltrpkafvvsvgkdatlscqivgnptpqvswekdqqpvaagarfrlaqdgdlyrlt
ildlalgdsgqyvcrarnaigeafaavglqvd

Timeline for d4c4ko1:

• d4c4ko1 first appeared in SCOPe 2.04, called d4c4ko_
  
• d4c4ko1 appears in SCOPe 2.07