Lineage for d4c4kt_ (4c4k T:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755815Domain d4c4kt_: 4c4k T: [259753]
    Other proteins in same PDB: d4c4ko2
    automated match to d2wwmd_
    complexed with edo

Details for d4c4kt_

PDB Entry: 4c4k (more details), 1.95 Å

PDB Description: crystal structure of the titin m10-obscurin ig domain 1 complex
PDB Compounds: (T:) titin

SCOPe Domain Sequences for d4c4kt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c4kt_ b.1.1.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientddl
ttliimdvqkqdgglytlslgnefgsdsatvnihirs

SCOPe Domain Coordinates for d4c4kt_:

Click to download the PDB-style file with coordinates for d4c4kt_.
(The format of our PDB-style files is described here.)

Timeline for d4c4kt_: