SCOPe 2.07: Domain d4c2xa2: 4c2x A:296-496

Lineage for d4c2xa2 (4c2x A:296-496)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries)

8. Domain d4c2xa2: 4c2x A:296-496 [259749]
   Other proteins in same PDB: d4c2xa3
   automated match to d3iu1a2
   complexed with mg, nhw

Details for d4c2xa2

PDB Entry: 4c2x, 2.33 Å

PDB Description: Human N-myristoyltransferase isoform 2 (NMT2)

PDB Compounds: (A:) glycylpeptide n-tetradecanoyltransferase 2

SCOPe Domain Sequences for d4c2xa2:

Sequence; same for both SEQRES and ATOM records:

>d4c2xa2 d.108.1.0 (A:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnpkklvevkfshlsrnmtlqrtmklyrlpdvtktsglrpmepkdiksvrelint
ylkqfhlapvmdeeevahwflprehiidtfvvespngkltdflsfytlpstvmhhpahks
lkaaysfynihtetplldlmsdalilakskgfdvfnaldlmenktfleklkfgigdgnlq
yylynwrcpgtdsekvglvlq

Timeline for d4c2xa2:

• d4c2xa2 first appeared in SCOPe 2.04
  
• d4c2xa2 appears in SCOPe 2.06
  
• d4c2xa2 appears in the current release, SCOPe 2.08