SCOPe 2.08: Domain d4c2zb1: 4c2z B:115-295

Lineage for d4c2zb1 (4c2z B:115-295)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)

8. Domain d4c2zb1: 4c2z B:115-295 [259746]
   automated match to d3iu1a1
   complexed with 646, cit, cl, gol, mg, mya

Details for d4c2zb1

PDB Entry: 4c2z, 2.08 Å

PDB Description: Human N-myristoyltransferase (NMT1) with Myristoyl-CoA and inhibitor bound

PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d4c2zb1:

Sequence; same for both SEQRES and ATOM records:

>d4c2zb1 d.108.1.0 (B:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
r

Timeline for d4c2zb1:

• d4c2zb1 first appeared in SCOPe 2.04
  
• d4c2zb1 appears in SCOPe 2.07