SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wifb2 (3wif B:113-216)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (12 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (451 PDB entries)
  8. 2025444Domain d3wifb2: 3wif B:113-216 [259740]
    Other proteins in same PDB: d3wifb1
    automated match to d2ojzl2
    complexed with on5

Details for d3wifb2

PDB Entry: 3wif (more details), 1.7 Å

PDB Description: Crystal structure of anti-prostaglandin E2 Fab fragment 9Cl-PGF2beta complex
PDB Compounds: (B:) mAb Fab L fragment

SCOPe Domain Sequences for d3wifb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wifb2 b.1.1.2 (B:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3wifb2:

Click to download the PDB-style file with coordinates for d3wifb2.
(The format of our PDB-style files is described here.)

Timeline for d3wifb2: