Lineage for d3wifb1 (3wif B:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744242Domain d3wifb1: 3wif B:1-112 [259739]
    Other proteins in same PDB: d3wifb2
    automated match to d2ok0l1
    complexed with on5

Details for d3wifb1

PDB Entry: 3wif (more details), 1.7 Å

PDB Description: Crystal structure of anti-prostaglandin E2 Fab fragment 9Cl-PGF2beta complex
PDB Compounds: (B:) mAb Fab L fragment

SCOPe Domain Sequences for d3wifb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wifb1 b.1.1.1 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkinrveaedlgiyyclqgshvpltfgagttlelk

SCOPe Domain Coordinates for d3wifb1:

Click to download the PDB-style file with coordinates for d3wifb1.
(The format of our PDB-style files is described here.)

Timeline for d3wifb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wifb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3wifa_