SCOPe 2.05: Domain d4wd6a_: 4wd6 A:

Lineage for d4wd6a_ (4wd6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (15 species)
   not a true protein

7. Species Pseudomonas stutzeri [TaxId:316] [259737] (2 PDB entries)

8. Domain d4wd6a_: 4wd6 A: [259738]
   automated match to d1jjtb_
   complexed with zn

Details for d4wd6a_

PDB Entry: 4wd6, 2.2 Å

PDB Description: Crystal Structure of DIM-1 metallo-beta-lactamase

PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d4wd6a_:

Sequence; same for both SEQRES and ATOM records:

>d4wd6a_ d.157.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
devpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlvh
wirkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgn
estlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsr
saqnalsryseaqivipghgkigdiallkhtkslaetas

Timeline for d4wd6a_:

• d4wd6a_ first appeared in SCOPe 2.04
  
• d4wd6a_ appears in SCOPe 2.06
  
• d4wd6a_ appears in the current release, SCOPe 2.08