Lineage for d4wd6a_ (4wd6 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679746Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1679747Protein automated matches [190418] (12 species)
    not a true protein
  7. 1679872Species Pseudomonas stutzeri [TaxId:316] [259737] (1 PDB entry)
  8. 1679873Domain d4wd6a_: 4wd6 A: [259738]
    automated match to d1jjtb_
    complexed with zn

Details for d4wd6a_

PDB Entry: 4wd6 (more details), 2.2 Å

PDB Description: Crystal Structure of DIM-1 metallo-beta-lactamase
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d4wd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wd6a_ d.157.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
devpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlvh
wirkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgn
estlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsr
saqnalsryseaqivipghgkigdiallkhtkslaetas

SCOPe Domain Coordinates for d4wd6a_:

Click to download the PDB-style file with coordinates for d4wd6a_.
(The format of our PDB-style files is described here.)

Timeline for d4wd6a_: