Lineage for d4uyea_ (4uye A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1487795Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)
  8. 1487920Domain d4uyea_: 4uye A: [259734]
    automated match to d4lc2a_
    complexed with 9f9, edo

Details for d4uyea_

PDB Entry: 4uye (more details), 1.65 Å

PDB Description: bromodomain of human brpf1 with n-1,3-dimethyl-2-oxo-6-(piperidin-1- yl)-2,3-dihydro-1h-1,3-benzodiazol-5-yl-2-methoxybenzamide
PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d4uyea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uyea_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayryl
nfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqae

SCOPe Domain Coordinates for d4uyea_:

Click to download the PDB-style file with coordinates for d4uyea_.
(The format of our PDB-style files is described here.)

Timeline for d4uyea_: