Lineage for d4u6vm2 (4u6v M:106-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751260Domain d4u6vm2: 4u6v M:106-213 [259732]
    Other proteins in same PDB: d4u6va_, d4u6vb_, d4u6vh_, d4u6vk_, d4u6vl1, d4u6vm1
    automated match to d1dn0a2
    complexed with so4

Details for d4u6vm2

PDB Entry: 4u6v (more details), 2.56 Å

PDB Description: Mechanisms of Neutralization of a Human Anti-Alpha Toxin Antibody
PDB Compounds: (M:) Fab, antigen binding fragment, light chain

SCOPe Domain Sequences for d4u6vm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u6vm2 b.1.1.2 (M:106-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4u6vm2:

Click to download the PDB-style file with coordinates for d4u6vm2.
(The format of our PDB-style files is described here.)

Timeline for d4u6vm2: