Lineage for d4u6vm1 (4u6v M:1-105)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2027788Domain d4u6vm1: 4u6v M:1-105 [259731]
    Other proteins in same PDB: d4u6va_, d4u6vb_, d4u6vl2, d4u6vm2
    automated match to d1dn0a1
    complexed with so4

Details for d4u6vm1

PDB Entry: 4u6v (more details), 2.56 Å

PDB Description: Mechanisms of Neutralization of a Human Anti-Alpha Toxin Antibody
PDB Compounds: (M:) Fab, antigen binding fragment, light chain

SCOPe Domain Sequences for d4u6vm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u6vm1 b.1.1.0 (M:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykasslesgvps
rfsgsgsgteftltisslqpddfatyyckqyadywtfgqgtkvei

SCOPe Domain Coordinates for d4u6vm1:

Click to download the PDB-style file with coordinates for d4u6vm1.
(The format of our PDB-style files is described here.)

Timeline for d4u6vm1: