Lineage for d4uamc_ (4uam C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231303Species Pseudomonas aeruginosa [TaxId:1089456] [259726] (1 PDB entry)
  8. 2231306Domain d4uamc_: 4uam C: [259727]
    automated match to d1jjta_
    complexed with fe, flc, zn

Details for d4uamc_

PDB Entry: 4uam (more details), 1.8 Å

PDB Description: 1.8 angstrom crystal structure of imp-1 metallo-beta-lactamase with a mixed iron-zinc center in the active site
PDB Compounds: (C:) IMP-1 metallo-beta-lactamase

SCOPe Domain Sequences for d4uamc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uamc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa [TaxId: 1089456]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglneskk

SCOPe Domain Coordinates for d4uamc_:

Click to download the PDB-style file with coordinates for d4uamc_.
(The format of our PDB-style files is described here.)

Timeline for d4uamc_: