Lineage for d4tria1 (4tri A:5-401)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005724Species Mycobacterium smegmatis [TaxId:246196] [231662] (5 PDB entries)
  8. 2005736Domain d4tria1: 4tri A:5-401 [259722]
    Other proteins in same PDB: d4tria2
    automated match to d3zbyd_
    complexed with c3s, gol, hem

Details for d4tria1

PDB Entry: 4tri (more details), 2 Å

PDB Description: x-ray crystal structure of cyp142a2 from mycobacterium smegmatis, complexed with cholesterol sulfate.
PDB Compounds: (A:) p450 heme-thiolate protein

SCOPe Domain Sequences for d4tria1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tria1 a.104.1.0 (A:5-401) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
ltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpelfss
tggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavcerg
ecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdtfaa
yteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrhtlsg
gteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelrageki
mlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervlrrl
pdlrladdapvplrpanfvsgpesmpvvftpsapvla

SCOPe Domain Coordinates for d4tria1:

Click to download the PDB-style file with coordinates for d4tria1.
(The format of our PDB-style files is described here.)

Timeline for d4tria1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tria2
View in 3D
Domains from other chains:
(mouse over for more information)
d4trib_