Lineage for d4r9na1 (4r9n A:61-311)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151246Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2151247Protein automated matches [191112] (14 species)
    not a true protein
  7. 2151331Species Listeria monocytogenes [TaxId:169963] [259718] (1 PDB entry)
  8. 2151332Domain d4r9na1: 4r9n A:61-311 [259719]
    Other proteins in same PDB: d4r9na2
    automated match to d3efbd_

Details for d4r9na1

PDB Entry: 4r9n (more details), 1.87 Å

PDB Description: deor family transcriptional regulator from listeria monocytogenes.
PDB Compounds: (A:) Lmo0547 protein

SCOPe Domain Sequences for d4r9na1:

Sequence, based on SEQRES records: (download)

>d4r9na1 c.124.1.0 (A:61-311) automated matches {Listeria monocytogenes [TaxId: 169963]}
tvdleqkleekfgleeaivvathdmseeealnflakeaaytlskriakvktlgiswgkti
rkfanefpfiphkdltiipliggmgssdidlhsnqicydlkkkmkchskylyapalvedt
emktdlsknkyisevleegktvdmaivgvsspynhstmeeigyinsedieelrykdvvgd
insrfftadgkeakteinthviglsleelkniptvvalanglqkkealvaalnaglidvi
vitdrmaeyil

Sequence, based on observed residues (ATOM records): (download)

>d4r9na1 c.124.1.0 (A:61-311) automated matches {Listeria monocytogenes [TaxId: 169963]}
tvdleqkleekfgleeaivvathdmseeealnflakeaaytlskriakvktlgiswgkti
rkfanefpfiphkdltiipliggdlhsnqicydlkkkmkchskylyapalvedtemktdl
sknkyisevleegktvdmaivgvsspynhstmeeigyinsedieelrykdvvgdinsrff
tadgkeakteinthviglsleelkniptvvalanglqkkealvaalnaglidvivitdrm
aeyil

SCOPe Domain Coordinates for d4r9na1:

Click to download the PDB-style file with coordinates for d4r9na1.
(The format of our PDB-style files is described here.)

Timeline for d4r9na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r9na2