Lineage for d4r7ja1 (4r7j A:1-481)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080748Species Campylobacter jejuni [TaxId:192222] [235705] (3 PDB entries)
  8. 2080749Domain d4r7ja1: 4r7j A:1-481 [259714]
    Other proteins in same PDB: d4r7ja2
    automated match to d4mz1a_
    complexed with cl, gol, imp, k, mpd, so4

Details for d4r7ja1

PDB Entry: 4r7j (more details), 2.12 Å

PDB Description: crystal structure of inosine 5'-monophosphate dehydrogenase with the internal deletion containing cbs domain from campylobacter jejuni
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4r7ja1:

Sequence, based on SEQRES records: (download)

>d4r7ja1 c.1.5.0 (A:1-481) automated matches {Campylobacter jejuni [TaxId: 192222]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkksesggikdlkkrkeypdankdnfgrlrvgaaig
vgqmdrvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakal
ceagvdavkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdi
akalavgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqkgssdryfqqgt
aqdklvpegiegrvpyvgsirsvvhqllgglrssmgyvgakdiedfqkraefveittagl
keshvhdvtitheapnyk

Sequence, based on observed residues (ATOM records): (download)

>d4r7ja1 c.1.5.0 (A:1-481) automated matches {Campylobacter jejuni [TaxId: 192222]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkksekkrkeypdankdnfgrlrvgaaigvgqmdrv
dalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvda
vkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavg
assvmigsllagtdespgelftyqgrqyksyrgmgslgamqklvpegiegrvpyvgsirs
vvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk

SCOPe Domain Coordinates for d4r7ja1:

Click to download the PDB-style file with coordinates for d4r7ja1.
(The format of our PDB-style files is described here.)

Timeline for d4r7ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r7ja2