Lineage for d4qt8c_ (4qt8 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058190Species Human (Homo sapiens) [TaxId:9606] [187421] (73 PDB entries)
  8. 2058273Domain d4qt8c_: 4qt8 C: [259712]
    automated match to d2asub_

Details for d4qt8c_

PDB Entry: 4qt8 (more details), 3 Å

PDB Description: crystal structure of ron sema-psi-ipt1 extracellular domains in complex with msp beta-chain
PDB Compounds: (C:) Hepatocyte growth factor-like protein

SCOPe Domain Sequences for d4qt8c_:

Sequence, based on SEQRES records: (download)

>d4qt8c_ b.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgkrvdrldqrrsklrvvgghpgnspwtvslrnrqgqhfcggslvkeqwiltarqcfssc
hmpltgyevwlgtlfqnpqhgepslqrvpvakmvcgpsgsqlvllklersvtlnqrvali
clppewyvvppgtkceiagwgetkgtgndtvlnvallnvisnqecnikhrgrvresemct
egllapvgacegdyggplacfthnswvlegiiipnrvcarsrwpavftrvsvfvdwihkv
mrl

Sequence, based on observed residues (ATOM records): (download)

>d4qt8c_ b.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgkrvdrldqrrsklrvvgghpgnspwtvslrnrqgqhfcggslvkeqwiltarqcfssc
hmpltgyevwlgtlfqnepslqrvpvakmvcgpsgsqlvllklersvtlnqrvaliclpp
ewyvvppgtkceiagwdtvlnvallnvisnqecnikhrgrvresemctegllapvgaceg
dyggplacfthnswvlegiiipnrvcarsrwpavftrvsvfvdwihkvmrl

SCOPe Domain Coordinates for d4qt8c_:

Click to download the PDB-style file with coordinates for d4qt8c_.
(The format of our PDB-style files is described here.)

Timeline for d4qt8c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4qt8d_