Lineage for d4q2zl2 (4q2z L:108-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753422Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)
  8. 2753438Domain d4q2zl2: 4q2z L:108-208 [259704]
    Other proteins in same PDB: d4q2za_, d4q2zb1, d4q2zh_, d4q2zl1
    automated match to d1rzfl2

Details for d4q2zl2

PDB Entry: 4q2z (more details), 1.93 Å

PDB Description: Fab fragment of HIV vaccine-elicited CD4bs-directed antibody, GE356, from a non-human primate
PDB Compounds: (L:) Light chain of Fab fragment of HIV vaccine-elicited CD4bs-directed antibody

SCOPe Domain Sequences for d4q2zl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q2zl2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4q2zl2:

Click to download the PDB-style file with coordinates for d4q2zl2.
(The format of our PDB-style files is described here.)

Timeline for d4q2zl2: