SCOPe 2.08: Domain d4q2zl2: 4q2z L:108-208

Lineage for d4q2zl2 (4q2z L:108-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d4q2zl2: 4q2z L:108-208 [259704]
   Other proteins in same PDB: d4q2za_, d4q2zb1, d4q2zh_, d4q2zl1
   automated match to d1rzfl2

Details for d4q2zl2

PDB Entry: 4q2z, 1.93 Å

PDB Description: Fab fragment of HIV vaccine-elicited CD4bs-directed antibody, GE356, from a non-human primate

PDB Compounds: (L:) Light chain of Fab fragment of HIV vaccine-elicited CD4bs-directed antibody

SCOPe Domain Sequences for d4q2zl2:

Sequence; same for both SEQRES and ATOM records:

>d4q2zl2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4q2zl2:

• d4q2zl2 first appeared in SCOPe 2.04
  
• d4q2zl2 appears in SCOPe 2.07