SCOPe 2.08: Domain d4q2zl1: 4q2z L:1-107

Lineage for d4q2zl1 (4q2z L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)

8. Domain d4q2zl1: 4q2z L:1-107 [259703]
   Other proteins in same PDB: d4q2zb2, d4q2zl2
   automated match to d1rzfl1

Details for d4q2zl1

PDB Entry: 4q2z, 1.93 Å

PDB Description: Fab fragment of HIV vaccine-elicited CD4bs-directed antibody, GE356, from a non-human primate

PDB Compounds: (L:) Light chain of Fab fragment of HIV vaccine-elicited CD4bs-directed antibody

SCOPe Domain Sequences for d4q2zl1:

Sequence; same for both SEQRES and ATOM records:

>d4q2zl1 b.1.1.0 (L:1-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qsvltqppsvsgapgqkvtisctgsssniggydvhwyqqlpgmapklliydnnerpsgis
drfsgsksatsaslaitglqtedeadyycqsydsslnawvfgggtrltvlg

Timeline for d4q2zl1:

• d4q2zl1 first appeared in SCOPe 2.04
  
• d4q2zl1 appears in SCOPe 2.07