SCOP 1.61: Domain d1an1e_: 1an1 E:

Lineage for d1an1e_ (1an1 E:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50517] (14 PDB entries)

8. Domain d1an1e_: 1an1 E: [25970]
   Other proteins in same PDB: d1an1i_

Details for d1an1e_

PDB Entry: 1an1, 2.03 Å

PDB Description: leech-derived tryptase inhibitor/trypsin complex

SCOP Domain Sequences for d1an1e_:

Sequence; same for both SEQRES and ATOM records:

>d1an1e_ b.47.1.2 (E:) Trypsin(ogen) {Pig (Sus scrofa)}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatldsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

Timeline for d1an1e_:

• d1an1e_ first appeared (with stable ids) in SCOP 1.55
  
• d1an1e_ appears in SCOP 1.59
  
• d1an1e_ appears in SCOP 1.63
  
• d1an1e_ appears in the current release, SCOPe 2.08