Lineage for d1an1e_ (1an1 E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 112135Protein Trypsin(ogen) [50515] (7 species)
  7. 112315Species Pig (Sus scrofa) [TaxId:9823] [50517] (14 PDB entries)
  8. 112325Domain d1an1e_: 1an1 E: [25970]
    Other proteins in same PDB: d1an1i_

Details for d1an1e_

PDB Entry: 1an1 (more details), 2.03 Å

PDB Description: leech-derived tryptase inhibitor/trypsin complex

SCOP Domain Sequences for d1an1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an1e_ b.47.1.2 (E:) Trypsin(ogen) {Pig (Sus scrofa)}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatldsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

SCOP Domain Coordinates for d1an1e_:

Click to download the PDB-style file with coordinates for d1an1e_.
(The format of our PDB-style files is described here.)

Timeline for d1an1e_: