Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (75 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [259694] (1 PDB entry) |
Domain d4ph6b_: 4ph6 B: [259695] automated match to d3js3a_ |
PDB Entry: 4ph6 (more details), 2.2 Å
SCOPe Domain Sequences for d4ph6b_:
Sequence, based on SEQRES records: (download)
>d4ph6b_ c.1.10.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]} pvivknvrigegnpkivvpivaptaedilaeatasqtldcdlvewrldyyenvadfsdvc nlsqqvmerlgqkpllltfrtqkeggemafseenyfalyhelvkkgaldlldielfanpl aadtliheakkagikivlcnhdfqktpsqeeivarlrqmqmrqadickiavmpqdatdvl tllsatnemythyasvpivtmsmgqlgmisrvtgqlfgsaltfgsaqqasapgqlsvqvl rnylktfeq
>d4ph6b_ c.1.10.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]} pvivknvrigegnpkivvpivaptaedilaeatasqtldcdlvewrldyyenvadfsdvc nlsqqvmerlgqkpllltfrtqkeggemafseenyfalyhelvkkgaldlldielfanpl aadtliheakkagikivlcnhdfqktpsqeeivarlrqmqmrqadickiavmpqdatdvl tllsatnemythyasvpivtmsmgqlgmisrvtgqlfgsaltfgslsvqvlrnylktfeq
Timeline for d4ph6b_: