Lineage for d4ph6b_ (4ph6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086616Species Enterococcus faecalis [TaxId:226185] [259694] (1 PDB entry)
  8. 2086618Domain d4ph6b_: 4ph6 B: [259695]
    automated match to d3js3a_

Details for d4ph6b_

PDB Entry: 4ph6 (more details), 2.2 Å

PDB Description: Structure of 3-Dehydroquinate Dehydratase from Enterococcus faecalis
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4ph6b_:

Sequence, based on SEQRES records: (download)

>d4ph6b_ c.1.10.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
pvivknvrigegnpkivvpivaptaedilaeatasqtldcdlvewrldyyenvadfsdvc
nlsqqvmerlgqkpllltfrtqkeggemafseenyfalyhelvkkgaldlldielfanpl
aadtliheakkagikivlcnhdfqktpsqeeivarlrqmqmrqadickiavmpqdatdvl
tllsatnemythyasvpivtmsmgqlgmisrvtgqlfgsaltfgsaqqasapgqlsvqvl
rnylktfeq

Sequence, based on observed residues (ATOM records): (download)

>d4ph6b_ c.1.10.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
pvivknvrigegnpkivvpivaptaedilaeatasqtldcdlvewrldyyenvadfsdvc
nlsqqvmerlgqkpllltfrtqkeggemafseenyfalyhelvkkgaldlldielfanpl
aadtliheakkagikivlcnhdfqktpsqeeivarlrqmqmrqadickiavmpqdatdvl
tllsatnemythyasvpivtmsmgqlgmisrvtgqlfgsaltfgslsvqvlrnylktfeq

SCOPe Domain Coordinates for d4ph6b_:

Click to download the PDB-style file with coordinates for d4ph6b_.
(The format of our PDB-style files is described here.)

Timeline for d4ph6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ph6a_