SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4pa1a1 (4pa1 A:61-209)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2124901Species Feline immunodeficiency virus [TaxId:11674] [259692] (1 PDB entry)
  8. 2124902Domain d4pa1a1: 4pa1 A:61-209 [259693]
    Other proteins in same PDB: d4pa1a2
    automated match to d3kksb_

Details for d4pa1a1

PDB Entry: 4pa1 (more details), 1.84 Å

PDB Description: Crystal Structure of Catalytic Core domain of FIV Integrase
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4pa1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pa1a1 c.55.3.0 (A:61-209) automated matches {Feline immunodeficiency virus [TaxId: 11674]}
giwqmdcthfdgkiilvgihvesgyiwaqiisqetadctvkavlqllsahnvtelqtdng
pnfknqkmegvlnymgvkhkfgipgnpqsqalvenvnhtlkvwiqkflpettsldnalsl
avhslnfkrrgriggmapyellaqqeslr

SCOPe Domain Coordinates for d4pa1a1:

Click to download the PDB-style file with coordinates for d4pa1a1.
(The format of our PDB-style files is described here.)

Timeline for d4pa1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pa1a2