SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d4pa1a1 (4pa1 A:61-209)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (15 families) 
consists of one domain of this fold
Family c.55.3.0: automated matches [191357] (1 protein)
not a true familyProtein automated matches [190396] (34 species)
not a true protein
Species Feline immunodeficiency virus [TaxId:11674] [259692] (1 PDB entry) 
Domain d4pa1a1: 4pa1 A:61-209 [259693]
Other proteins in same PDB: d4pa1a2
automated match to d3kksb_
Details for d4pa1a1
PDB Entry: 4pa1 (more details), 1.84 Å
PDB Description: Crystal Structure of Catalytic Core domain of FIV Integrase
PDB Compounds: (A:) integraseSCOPe Domain Sequences for d4pa1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pa1a1 c.55.3.0 (A:61-209) automated matches {Feline immunodeficiency virus [TaxId: 11674]}
giwqmdcthfdgkiilvgihvesgyiwaqiisqetadctvkavlqllsahnvtelqtdng
pnfknqkmegvlnymgvkhkfgipgnpqsqalvenvnhtlkvwiqkflpettsldnalsl
avhslnfkrrgriggmapyellaqqeslr
SCOPe Domain Coordinates for d4pa1a1:
Click to download the PDB-style file with coordinates for d4pa1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4pa1a1:
- d4pa1a1 first appeared in SCOPe 2.04, called d4pa1a_
- d4pa1a1 was called d4pa1a_ in SCOPe 2.05
View in 3D
