Lineage for d4pa1a1 (4pa1 A:61-209)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2124901Species Feline immunodeficiency virus [TaxId:11674] [259692] (1 PDB entry)
  8. 2124902Domain d4pa1a1: 4pa1 A:61-209 [259693]
    Other proteins in same PDB: d4pa1a2
    automated match to d3kksb_

Details for d4pa1a1

PDB Entry: 4pa1 (more details), 1.84 Å

PDB Description: Crystal Structure of Catalytic Core domain of FIV Integrase
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4pa1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pa1a1 c.55.3.0 (A:61-209) automated matches {Feline immunodeficiency virus [TaxId: 11674]}
giwqmdcthfdgkiilvgihvesgyiwaqiisqetadctvkavlqllsahnvtelqtdng
pnfknqkmegvlnymgvkhkfgipgnpqsqalvenvnhtlkvwiqkflpettsldnalsl
avhslnfkrrgriggmapyellaqqeslr

SCOPe Domain Coordinates for d4pa1a1:

Click to download the PDB-style file with coordinates for d4pa1a1.
(The format of our PDB-style files is described here.)

Timeline for d4pa1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pa1a2