![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (36 species) not a true protein |
![]() | Species Feline immunodeficiency virus [TaxId:11674] [259692] (1 PDB entry) |
![]() | Domain d4pa1a1: 4pa1 A:61-209 [259693] Other proteins in same PDB: d4pa1a2 automated match to d3kksb_ |
PDB Entry: 4pa1 (more details), 1.84 Å
SCOPe Domain Sequences for d4pa1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pa1a1 c.55.3.0 (A:61-209) automated matches {Feline immunodeficiency virus [TaxId: 11674]} giwqmdcthfdgkiilvgihvesgyiwaqiisqetadctvkavlqllsahnvtelqtdng pnfknqkmegvlnymgvkhkfgipgnpqsqalvenvnhtlkvwiqkflpettsldnalsl avhslnfkrrgriggmapyellaqqeslr
Timeline for d4pa1a1: