SCOPe 2.07: Domain d4pa1a1: 4pa1 A:61-209

Lineage for d4pa1a1 (4pa1 A:61-209)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (36 species)
   not a true protein

7. Species Feline immunodeficiency virus [TaxId:11674] [259692] (1 PDB entry)

8. Domain d4pa1a1: 4pa1 A:61-209 [259693]
   Other proteins in same PDB: d4pa1a2
   automated match to d3kksb_

Details for d4pa1a1

PDB Entry: 4pa1, 1.84 Å

PDB Description: Crystal Structure of Catalytic Core domain of FIV Integrase

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4pa1a1:

Sequence; same for both SEQRES and ATOM records:

>d4pa1a1 c.55.3.0 (A:61-209) automated matches {Feline immunodeficiency virus [TaxId: 11674]}
giwqmdcthfdgkiilvgihvesgyiwaqiisqetadctvkavlqllsahnvtelqtdng
pnfknqkmegvlnymgvkhkfgipgnpqsqalvenvnhtlkvwiqkflpettsldnalsl
avhslnfkrrgriggmapyellaqqeslr

Timeline for d4pa1a1:

• d4pa1a1 first appeared in SCOPe 2.04, called d4pa1a_
  
• d4pa1a1 appears in SCOPe 2.06