SCOP 1.61: Domain d1aks.1: 1aks A:,B:

Lineage for d1aks.1 (1aks A:,B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50517] (14 PDB entries)

8. Domain d1aks.1: 1aks A:,B: [25969]

Details for d1aks.1

PDB Entry: 1aks, 1.8 Å

PDB Description: crystal structure of the first active autolysate form of the porcine alpha trypsin

SCOP Domain Sequences for d1aks.1:

Sequence; same for both SEQRES and ATOM records:

>g1aks.1 b.47.1.2 (A:,B:) Trypsin(ogen) {Pig (Sus scrofa)}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkXssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsgg
pvvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

Timeline for d1aks.1:

• d1aks.1 first appeared (with stable ids) in SCOP 1.55
  
• d1aks.1 appears in SCOP 1.59
  
• d1aks.1 appears in SCOP 1.63
  
• d1aks.1 appears in the current release, SCOPe 2.08