Lineage for d1aks.1 (1aks A:,B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2388843Protein Trypsin(ogen) [50515] (9 species)
  7. 2389400Species Pig (Sus scrofa) [TaxId:9823] [50517] (34 PDB entries)
    Uniprot P00761 9-231 ! Uniprot P00761
  8. 2389412Domain d1aks.1: 1aks A:,B: [25969]
    complexed with ca

Details for d1aks.1

PDB Entry: 1aks (more details), 1.8 Å

PDB Description: crystal structure of the first active autolysate form of the porcine alpha trypsin
PDB Compounds: (A:) alpha trypsin, (B:) alpha trypsin

SCOPe Domain Sequences for d1aks.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1aks.1 b.47.1.2 (A:,B:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkXssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsgg
pvvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

SCOPe Domain Coordinates for d1aks.1:

Click to download the PDB-style file with coordinates for d1aks.1.
(The format of our PDB-style files is described here.)

Timeline for d1aks.1: