Lineage for d4p2mb_ (4p2m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954913Species Mycobacterium tuberculosis [225049] (4 PDB entries)
  8. 2954918Domain d4p2mb_: 4p2m B: [259684]
    automated match to d1yk9a_
    complexed with peg, so4

Details for d4p2mb_

PDB Entry: 4p2m (more details), 2.7 Å

PDB Description: swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 1
PDB Compounds: (B:) adenylate cyclase

SCOPe Domain Sequences for d4p2mb_:

Sequence, based on SEQRES records: (download)

>d4p2mb_ d.58.29.0 (B:) automated matches {Mycobacterium tuberculosis}
rniiadkydeasvlfadivgfterasstapadlvrfldrlysafdelvdqhglekikvsg
dsymvvsgvprprpdhtqaladfaldmtnvaaqlkdprgnpvplrvglatgpvvagvvgs
rrffydvwgdavnvasrmestdsvgqiqvpdevyerlkddfvlrerghinvkgkgvmrtw
yligrkvaa

Sequence, based on observed residues (ATOM records): (download)

>d4p2mb_ d.58.29.0 (B:) automated matches {Mycobacterium tuberculosis}
rniiadkydeasvlfadivgftdlvrfldrlysafdelvdqhglekikvsgdsymvvsgv
prprpdhtqaladfaldmtnvaaqlkdprgnpvplrvglatgpvvagvvgsrrffydvwg
davnvasrmestdsvgqiqvpdevyerlkddfvlrerghinkgkgvmrtwyligrkvaa

SCOPe Domain Coordinates for d4p2mb_:

Click to download the PDB-style file with coordinates for d4p2mb_.
(The format of our PDB-style files is described here.)

Timeline for d4p2mb_: