![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces griseoviridis [TaxId:45398] [259670] (1 PDB entry) |
![]() | Domain d4mm0a_: 4mm0 A: [259671] automated match to d2y5nb_ complexed with hem |
PDB Entry: 4mm0 (more details), 2.6 Å
SCOPe Domain Sequences for d4mm0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mm0a_ a.104.1.0 (A:) automated matches {Streptomyces griseoviridis [TaxId: 45398]} atrhpypfdravptaipplyeelretervaaitmatgdpgflvtryedvrfvlsdprfsv rqdlpgaprltemtfesvmttdppvhtrlrrllsrdftarriermrprleeiaeglldem ekkgapadiveslavpfpitvicellgvpmvdvarfrgwadtmvsltgysmedwtaarda lesyldglvaakrenpgsdllsalvataaedneltdhdvrslslilllagyepasnqlgs svltllrfpdrlaelrrdpgllpsaveelmryapagdgalfrvtledvtigdthipansa vlastqaanwdprrfddptglrldrpdnqhtalghgihfclgaalarvelqvaigallrr fprlalatdesglrwsspgsmlsgfaeipvtw
Timeline for d4mm0a_: