Lineage for d4mm0a_ (4mm0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2332195Species Streptomyces griseoviridis [TaxId:45398] [259670] (1 PDB entry)
  8. 2332196Domain d4mm0a_: 4mm0 A: [259671]
    automated match to d2y5nb_
    complexed with hem

Details for d4mm0a_

PDB Entry: 4mm0 (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of the Putative Thioether Synthase SgvP Involved in the Tailoring Step of Griseoviridin
PDB Compounds: (A:) P450-like monooxygenase

SCOPe Domain Sequences for d4mm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mm0a_ a.104.1.0 (A:) automated matches {Streptomyces griseoviridis [TaxId: 45398]}
atrhpypfdravptaipplyeelretervaaitmatgdpgflvtryedvrfvlsdprfsv
rqdlpgaprltemtfesvmttdppvhtrlrrllsrdftarriermrprleeiaeglldem
ekkgapadiveslavpfpitvicellgvpmvdvarfrgwadtmvsltgysmedwtaarda
lesyldglvaakrenpgsdllsalvataaedneltdhdvrslslilllagyepasnqlgs
svltllrfpdrlaelrrdpgllpsaveelmryapagdgalfrvtledvtigdthipansa
vlastqaanwdprrfddptglrldrpdnqhtalghgihfclgaalarvelqvaigallrr
fprlalatdesglrwsspgsmlsgfaeipvtw

SCOPe Domain Coordinates for d4mm0a_:

Click to download the PDB-style file with coordinates for d4mm0a_.
(The format of our PDB-style files is described here.)

Timeline for d4mm0a_: