Lineage for d1fmga_ (1fmg A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [50517] (13 PDB entries)
  8. 15489Domain d1fmga_: 1fmg A: [25967]

Details for d1fmga_

PDB Entry: 1fmg (more details), 1.9 Å

PDB Description: crystal structure of porcine beta trypsin with 0.04% polydocanol

SCOP Domain Sequences for d1fmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmga_ b.47.1.2 (A:) Trypsin(ogen) {Pig (Sus scrofa)}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

SCOP Domain Coordinates for d1fmga_:

Click to download the PDB-style file with coordinates for d1fmga_.
(The format of our PDB-style files is described here.)

Timeline for d1fmga_: