Lineage for d2m5ra1 (2m5r A:3-80)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993361Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1993481Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 1993482Protein automated matches [191038] (20 species)
    not a true protein
  7. 1993514Species Leishmania major [TaxId:5664] [259666] (1 PDB entry)
  8. 1993515Domain d2m5ra1: 2m5r A:3-80 [259667]
    Other proteins in same PDB: d2m5ra2
    automated match to d2x2ba_
    complexed with pns

Details for d2m5ra1

PDB Entry: 2m5r (more details)

PDB Description: Solution structure of holo-acyl carrier protein of Leishmania major
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2m5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m5ra1 a.28.1.0 (A:3-80) automated matches {Leishmania major [TaxId: 5664]}
dvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipdhdaek
iqsipdaveyiaqnpmak

SCOPe Domain Coordinates for d2m5ra1:

Click to download the PDB-style file with coordinates for d2m5ra1.
(The format of our PDB-style files is described here.)

Timeline for d2m5ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m5ra2