| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
| Protein automated matches [191038] (29 species) not a true protein |
| Species Leishmania major [TaxId:5664] [259666] (3 PDB entries) |
| Domain d2m5ra1: 2m5r A:3-80 [259667] Other proteins in same PDB: d2m5ra2 automated match to d2x2ba_ complexed with pns |
PDB Entry: 2m5r (more details)
SCOPe Domain Sequences for d2m5ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m5ra1 a.28.1.0 (A:3-80) automated matches {Leishmania major [TaxId: 5664]}
dvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipdhdaek
iqsipdaveyiaqnpmak
Timeline for d2m5ra1: