Lineage for d4luha3 (4luh A:388-583)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2010124Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2010125Protein automated matches [254493] (6 species)
    not a true protein
  7. 2010248Species Sheep (Ovis aries) [TaxId:9940] [259659] (3 PDB entries)
  8. 2010251Domain d4luha3: 4luh A:388-583 [259662]
    automated match to d4l8ua3
    complexed with 2q5, act, diu, fmt, lmr, mli, sin

Details for d4luha3

PDB Entry: 4luh (more details), 2.2 Å

PDB Description: Complex of ovine serum albumin with 3,5-diiodosalicylic acid
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4luha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4luha3 a.126.1.0 (A:388-583) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
kkncelfekhgeygfqnalivrytrkapqvstptlveisrslgkvgtkccakpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsdltldetyvpkpfdekfft
fhadictlpdtekqikkqtalvellkhkpkatdeqlktvmenfvafvdkccaaddkegcf
vlegpklvastqaala

SCOPe Domain Coordinates for d4luha3:

Click to download the PDB-style file with coordinates for d4luha3.
(The format of our PDB-style files is described here.)

Timeline for d4luha3: