SCOPe 2.07: Domain d4cava2: 4cav A:263-492

Lineage for d4cava2 (4cav A:263-492)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:746128] [259642] (6 PDB entries)

8. Domain d4cava2: 4cav A:263-492 [259646]
   automated match to d1iica2
   complexed with 2xq, cl, mya

Details for d4cava2

PDB Entry: 4cav, 1.89 Å

PDB Description: crystal structure of aspergillus fumigatus n-myristoyl transferase in complex with myristoyl coa and a benzofuran ligand r0-09-4879

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4cava2:

Sequence; same for both SEQRES and ATOM records:

>d4cava2 d.108.1.0 (A:263-492) automated matches {Aspergillus fumigatus [TaxId: 746128]}
yyhrpldwlklyevgfsplpagstkarqitknhlpsttstpglrpmepkdidtvhdllqr
ylsrfalnqaftreevdhwlvhkpetvkeqvvwayvvedpethkitdffsfynlestviq
npkhdnvraaylyyyatetaftnnmkalkerllmlmndalilakkahfdvfnaltlhdnp
lfleqlkfgagdgqlhfylynyrtapvpggvneknlpdekrmggvgivml

Timeline for d4cava2:

• d4cava2 first appeared in SCOPe 2.04
  
• d4cava2 appears in SCOPe 2.06
  
• d4cava2 appears in the current release, SCOPe 2.08