Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (42 species) not a true protein |
Species Aspergillus fumigatus [TaxId:746128] [259642] (6 PDB entries) |
Domain d4cava1: 4cav A:101-262 [259645] automated match to d1iica1 complexed with 2xq, cl, mya |
PDB Entry: 4cav (more details), 1.89 Å
SCOPe Domain Sequences for d4cava1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cava1 d.108.1.0 (A:101-262) automated matches {Aspergillus fumigatus [TaxId: 746128]} ggpikiidpekvskepdallegfewatldltnetelqelwdlltyhyveddnamfrfrys qsflhwalmspgwkkewhvgvratksrklvasicgvpteinvrnqklkvveinflcihkk lrskrltpvlikeitrrcylngiyqaiytagvvlptpvsscr
Timeline for d4cava1: