![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (28 species) not a true protein |
![]() | Species Aspergillus fumigatus [TaxId:746128] [259642] (5 PDB entries) |
![]() | Domain d4cawa2: 4caw A:263-492 [259644] automated match to d1iica2 complexed with mya, p3u |
PDB Entry: 4caw (more details), 2.5 Å
SCOPe Domain Sequences for d4cawa2:
Sequence, based on SEQRES records: (download)
>d4cawa2 d.108.1.0 (A:263-492) automated matches {Aspergillus fumigatus [TaxId: 746128]} yyhrpldwlklyevgfsplpagstkarqitknhlpsttstpglrpmepkdidtvhdllqr ylsrfalnqaftreevdhwlvhkpetvkeqvvwayvvedpethkitdffsfynlestviq npkhdnvraaylyyyatetaftnnmkalkerllmlmndalilakkahfdvfnaltlhdnp lfleqlkfgagdgqlhfylynyrtapvpggvneknlpdekrmggvgivml
>d4cawa2 d.108.1.0 (A:263-492) automated matches {Aspergillus fumigatus [TaxId: 746128]} yyhrpldwlklyevgfsplpagstkarqitknhlpsttstpglrpmepkdidtvhdllqr ylsrfalnqaftreevdhwlvhkpetvkeqvvwayvvedpethkitdffsfynlestviq npkhdnvraaylyyyatetaftmkalkerllmlmndalilakkahfdvfnaltlhdnplf leqlkfgagdgqlhfylynyrtapvpggvneknlpdekrmggvgivml
Timeline for d4cawa2: