SCOP 1.73: Domain d1fn6a_: 1fn6 A:

Lineage for d1fn6a_ (1fn6 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50517] (23 PDB entries)

8. Domain d1fn6a_: 1fn6 A: [25964]
   complexed with ca, edo, moh, so4

Details for d1fn6a_

PDB Entry: 1fn6, 1.8 Å

PDB Description: crystal structure of porcine beta trypsin with 0.1% polydocanol

PDB Compounds: (A:) Trypsin

SCOP Domain Sequences for d1fn6a_:

Sequence; same for both SEQRES and ATOM records:

>d1fn6a_ b.47.1.2 (A:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

Timeline for d1fn6a_:

• d1fn6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fn6a_ appears in SCOP 1.71
  
• d1fn6a_ appears in SCOP 1.75
  
• d1fn6a_ appears in the current release, SCOPe 2.08