Lineage for d4bv6a2 (4bv6 A:264-400)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849886Protein Apoptosis-inducing factor (AIF), middle domain [418937] (2 species)
  7. 2849887Species Human (Homo sapiens) [TaxId:9606] [419375] (2 PDB entries)
  8. 2849889Domain d4bv6a2: 4bv6 A:264-400 [259639]
    Other proteins in same PDB: d4bv6a1, d4bv6a3
    automated match to d1m6ia2
    complexed with fad, gol

Details for d4bv6a2

PDB Entry: 4bv6 (more details), 1.8 Å

PDB Description: Refined crystal structure of the human Apoptosis inducing factor
PDB Compounds: (A:) Apoptosis-inducing factor 1, mitochondrial

SCOPe Domain Sequences for d4bv6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bv6a2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF), middle domain {Human (Homo sapiens) [TaxId: 9606]}
prslsaidragaevksrttlfrkigdfrslekisrevksitiigggflgselacalgrka
ralgteviqlfpekgnmgkilpeylsnwtmekvrregvkvmpnaivqsvgvssgkllikl
kdgrkvetdhivaavgl

SCOPe Domain Coordinates for d4bv6a2:

Click to download the PDB-style file with coordinates for d4bv6a2.
(The format of our PDB-style files is described here.)

Timeline for d4bv6a2: