Lineage for d4bv6a1 (4bv6 A:127-263,A:401-477)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458195Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2458203Protein Apoptosis-inducing factor (AIF) [75126] (2 species)
  7. 2458204Species Human (Homo sapiens) [TaxId:9606] [75127] (2 PDB entries)
  8. 2458207Domain d4bv6a1: 4bv6 A:127-263,A:401-477 [259638]
    Other proteins in same PDB: d4bv6a3
    automated match to d1m6ia1
    complexed with fad, gol

Details for d4bv6a1

PDB Entry: 4bv6 (more details), 1.8 Å

PDB Description: Refined crystal structure of the human Apoptosis inducing factor
PDB Compounds: (A:) Apoptosis-inducing factor 1, mitochondrial

SCOPe Domain Sequences for d4bv6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bv6a1 c.3.1.5 (A:127-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}
kapshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfsddpn
vtktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvkln
dgsqityekcliatggtXepnvelaktggleidsdfggfrvnaelqarsniwvagdaacf
ydiklgrrrvehhdhavvsgrlagenmtgaakpyw

SCOPe Domain Coordinates for d4bv6a1:

Click to download the PDB-style file with coordinates for d4bv6a1.
(The format of our PDB-style files is described here.)

Timeline for d4bv6a1: