SCOPe 2.08: Domain d4bv6a1: 4bv6 A:127-263,A:401-477

Lineage for d4bv6a1 (4bv6 A:127-263,A:401-477)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Apoptosis-inducing factor (AIF), N- and C-terminal domain [418936] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419374] (2 PDB entries)

8. Domain d4bv6a1: 4bv6 A:127-263,A:401-477 [259638]
   Other proteins in same PDB: d4bv6a2, d4bv6a3
   automated match to d1m6ia1
   complexed with fad, gol
   has additional insertions and/or extensions that are not grouped together

Details for d4bv6a1

PDB Entry: 4bv6, 1.8 Å

PDB Description: Refined crystal structure of the human Apoptosis inducing factor

PDB Compounds: (A:) Apoptosis-inducing factor 1, mitochondrial

SCOPe Domain Sequences for d4bv6a1:

Sequence; same for both SEQRES and ATOM records:

>d4bv6a1 c.3.1.5 (A:127-263,A:401-477) Apoptosis-inducing factor (AIF), N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kapshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfsddpn
vtktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvkln
dgsqityekcliatggtXepnvelaktggleidsdfggfrvnaelqarsniwvagdaacf
ydiklgrrrvehhdhavvsgrlagenmtgaakpyw

Timeline for d4bv6a1:

• d4bv6a1 first appeared in SCOPe 2.04
  
• d4bv6a1 appears in SCOPe 2.07