| Class b: All beta proteins [48724] (180 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
| Protein automated matches [226946] (29 species) not a true protein |
| Species Aeropyrum pernix [TaxId:272557] [256138] (2 PDB entries) |
| Domain d3wxma2: 3wxm A:228-322 [259636] Other proteins in same PDB: d3wxma1, d3wxma3, d3wxmc1, d3wxmc3, d3wxme1, d3wxme3, d3wxmg1, d3wxmg3 automated match to d3agja2 protein/RNA complex; complexed with gtp, mg |
PDB Entry: 3wxm (more details), 2.3 Å
SCOPe Domain Sequences for d3wxma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxma2 b.43.3.0 (A:228-322) automated matches {Aeropyrum pernix [TaxId: 272557]}
pvdkplripvqnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlq
qaepgdnigfavrgvsksdikrgdvaghldkpptv
Timeline for d3wxma2: