Lineage for d3wxma2 (3wxm A:228-322)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793302Species Aeropyrum pernix [TaxId:272557] [256138] (2 PDB entries)
  8. 2793304Domain d3wxma2: 3wxm A:228-322 [259636]
    Other proteins in same PDB: d3wxma1, d3wxma3, d3wxmc1, d3wxmc3, d3wxme1, d3wxme3, d3wxmg1, d3wxmg3
    automated match to d3agja2
    protein/RNA complex; complexed with gtp, mg

Details for d3wxma2

PDB Entry: 3wxm (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3wxma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxma2 b.43.3.0 (A:228-322) automated matches {Aeropyrum pernix [TaxId: 272557]}
pvdkplripvqnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlq
qaepgdnigfavrgvsksdikrgdvaghldkpptv

SCOPe Domain Coordinates for d3wxma2:

Click to download the PDB-style file with coordinates for d3wxma2.
(The format of our PDB-style files is described here.)

Timeline for d3wxma2: