| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
| Family b.3.3.1: VHL [49469] (2 proteins) |
| Protein VHL [49470] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
| Domain d4w9fi_: 4w9f I: [259609] Other proteins in same PDB: d4w9fa_, d4w9fb1, d4w9fb2, d4w9fd_, d4w9fe_, d4w9fg_, d4w9fh_, d4w9fj_, d4w9fk1, d4w9fk2 automated match to d1lqbc_ complexed with 3ju |
PDB Entry: 4w9f (more details), 2.1 Å
SCOPe Domain Sequences for d4w9fi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9fi_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer
Timeline for d4w9fi_: