Lineage for d4w9ta_ (4w9t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079054Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 protein domains)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2079090Protein automated matches [190186] (10 species)
    not a true protein
  7. 2079111Species Streptomyces sp. [TaxId:465541] [259607] (2 PDB entries)
  8. 2079112Domain d4w9ta_: 4w9t A: [259608]
    automated match to d3zs4a_
    complexed with so4

Details for d4w9ta_

PDB Entry: 4w9t (more details), 1.57 Å

PDB Description: crystal structure of hisap from streptomyces sp. mg1
PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d4w9ta_:

Sequence, based on SEQRES records: (download)

>d4w9ta_ c.1.2.1 (A:) automated matches {Streptomyces sp. [TaxId: 465541]}
nklellpavdvrdgqavrlvhgvsgsetsygspleaalawqasgaewlhlvdldaafgtg
dnralvaeitgamdikvelsggirddaslaaalatgctrvnlgtaaletpewaakaiaeh
gdriavgldvrgttlkgrgwtseggdlyetlarldsegcaryvvtdigkdgtltgpnlel
lknvcaatdrpvvasggissledlralaalvpqgvegaivgkalyakaftleealkvvsa

Sequence, based on observed residues (ATOM records): (download)

>d4w9ta_ c.1.2.1 (A:) automated matches {Streptomyces sp. [TaxId: 465541]}
nklellpavdvrdgqavrlvhgvsgsetsygspleaalawqasgaewlhlvdldaafgtg
dnralvaeitgamdikvelsggirddaslaaalatgctrvnlgtaaletpewaakaiaeh
gdriavgldvrgttlkgrggdlyetlarldsegcaryvvtdigkdgtltgpnlellknvc
aatdrpvvasggissledlralaalvpqgvegaivgkalyakaftleealkvvsa

SCOPe Domain Coordinates for d4w9ta_:

Click to download the PDB-style file with coordinates for d4w9ta_.
(The format of our PDB-style files is described here.)

Timeline for d4w9ta_: