Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d4w9lf_: 4w9l F: [259601] Other proteins in same PDB: d4w9la_, d4w9lb_, d4w9ld_, d4w9le_, d4w9lg_, d4w9lh_, d4w9lj_, d4w9lk1, d4w9lk2 automated match to d1lqbc_ complexed with 3jj |
PDB Entry: 4w9l (more details), 2.2 Å
SCOPe Domain Sequences for d4w9lf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9lf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqer
Timeline for d4w9lf_: