SCOPe 2.04: Domain d4w9il_: 4w9i L:

Lineage for d4w9il_ (4w9i L:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)
   automatically mapped to Pfam PF01847

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (17 PDB entries)

8. Domain d4w9il_: 4w9i L: [259585]
   automated match to d1lqbc_
   complexed with 3js

Details for d4w9il_

PDB Entry: 4w9i, 2.4 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((2S,4R)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)

PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9il_:

Sequence; same for both SEQRES and ATOM records:

>d4w9il_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

Timeline for d4w9il_:

• d4w9il_ is new in SCOPe 2.04-stable
  
• d4w9il_ appears in SCOPe 2.05
  
• d4w9il_ appears in the current release, SCOPe 2.08