Lineage for d4w9if_ (4w9i F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768858Domain d4w9if_: 4w9i F: [259584]
    Other proteins in same PDB: d4w9ia_, d4w9ib_, d4w9id_, d4w9ie_, d4w9ig_, d4w9ih_, d4w9ij_, d4w9ik1, d4w9ik2
    automated match to d1lqbc_
    complexed with 3js

Details for d4w9if_

PDB Entry: 4w9i (more details), 2.4 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((2S,4R)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9if_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer

SCOPe Domain Coordinates for d4w9if_:

Click to download the PDB-style file with coordinates for d4w9if_.
(The format of our PDB-style files is described here.)

Timeline for d4w9if_: